missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NCF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Specifications
| Antigen | NCF1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18471632
|
Novus Biologicals
NBP2-33638-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18193583
|
Novus Biologicals
NBP2-33638 |
0.1 mL |
593.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NCF1 Polyclonal specifically detects NCF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NCF1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 47 kDa neutrophil oxidase factor, FLJ79451, NADPH oxidase organizer 2, NCF-1, NCF1A, neutrophil cytosol factor 1,47 kDa autosomal chronic granulomatous disease protein, neutrophil cytosolic factor 1, neutrophil cytosolic factor 1 (47kD, chronic granulomatous disease, autosomal1), neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1), Neutrophil NADPH oxidase factor 1, Nox organizer 2, NOXO2NCF-47K, Nox-organizing protein 2, p47phox, SH3 and PX domain-containing protein 1A, SH3PXD1Ap47-phox | |
| NCF1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P14598 | |
| 653361 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title