missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 550.00 €
Specifications
| Antigen | NDE1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30226447
|
Novus Biologicals
NBP3-38386-100ul |
100 μL |
550.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227615
|
Novus Biologicals
NBP3-38386-20ul |
20 μL |
190.00 €
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NDE1 Polyclonal antibody specifically detects NDE1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)Specifications
| NDE1 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.3), 50% glycerol | |
| 54820 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| FLJ20101, HOM-TES-87, nuclear distribution protein nudE homolog 1, NudE, nudE nuclear distribution gene E homolog 1 (A. nidulans), NUDE1, rat homolog | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human NDE1 (NP_060138.1).,, Sequence:, MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title