missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDRG4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00 € - 572.00 €
Specifications
| Antigen | NDRG4 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18456900
|
Novus Biologicals
NBP1-81434-25ul |
25 μL |
433.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18465950
|
Novus Biologicals
NBP1-81434 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NDRG4 Polyclonal antibody specifically detects NDRG4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| NDRG4 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cytokine Research | |
| PBS (pH 7.2) and 40% Glycerol | |
| 65009 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BDM1, Brain development-related molecule 1, DKFZp686I1615, FLJ30586, KIAA1180FLJ42011, NDRG family member 4, protein NDRG4, SMAP-8MGC19632, smooth muscle-associated protein 8, Vascular smooth muscle cell-associated protein 8 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title