missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NEDD8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 529.00 €
Specifications
| Antigen | NEDD8 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18636718
|
Novus Biologicals
NBP2-68600-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18634397
|
Novus Biologicals
NBP2-68600 |
100 μg |
529.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NEDD8 Polyclonal antibody specifically detects NEDD8 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| NEDD8 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol | |
| 4738 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ43224, MGC104393, MGC125896, MGC125897, NEDD-8, Neddylin, Neural precursor cell expressed developmentally down-regulated protein 8, neural precursor cell expressed, developmentally down-regulated 8, Ubiquitin-like protein Nedd8 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title