missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NET1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13653
This item is not returnable.
View return policy
Description
NET1 Polyclonal specifically detects NET1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| NET1 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200-1:500 | |
| ARHGEF8neuroepithelial cell-transforming gene 1 protein, guanine nucleotide regulatory protein (oncogene), NET1A, neuroepithelial cell transforming 1, neuroepithelial cell transforming gene 1, neuroepithelioma transforming gene 1, p65 Net1 proto-oncogene protein, Proto-oncogene p65 Net1, Rho guanine nucleotide exchange factor (GEF) 8, Rho guanine nucleotide exchange factor 8, small GTP-binding protein regulator | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 10276 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| NET1 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: PSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETL | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction