missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neuropilin-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-86866
This item is not returnable.
View return policy
Description
Neuropilin-2 Polyclonal specifically detects Neuropilin-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| This antibody was developed against Recombinant Protein corresponding to amino acids:LSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYL | |
| 0.1 mL |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction