missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NF-L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58699
This item is not returnable.
View return policy
Description
NF-L Polyclonal specifically detects NF-L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| NF-L | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| 68 kDa neurofilament protein, neurofilament protein, light chain, neurofilament subunit NF-L, Neurofilament triplet L protein, neurofilament, light polypeptide, neurofilament-light, NF68FLJ53642, NF-L, NFLlight polypeptide 68kDa | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| NEFL | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF | |
| 100 μL | |
| Autophagy, Cellular Markers, Cytoskeleton Markers, Neurodegeneration, Neurofilaments, Neuronal Cell Markers, Neuroscience | |
| 4747 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction