missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NHLH1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 470.00 €
Specifications
| Antigen | NHLH1 |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18660171
|
Novus Biologicals
NBP2-93392-0.02ml |
0.02 mL |
190.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18604271
|
Novus Biologicals
NBP2-93392-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NHLH1 Polyclonal antibody specifically detects NHLH1 in Human samples. It is validated for Western BlotSpecifications
| NHLH1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Neuroscience | |
| PBS (pH 7.3), 50% glycerol | |
| 4807 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BHLHA35, bHLHa35HEN-1, helix-loop-helix protein 1, HEN1NSCL-1, nescient helix loop helix 1Class A basic helix-loop-helix protein 35, NSCL, NSCL1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human NHLH1 (NP_005589.1). MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title