missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NKIRAS1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93958-0.1ml
This item is not returnable.
View return policy
Description
NKIRAS1 Polyclonal antibody specifically detects NKIRAS1 in Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| NKIRAS1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| I-kappa-B-interacting Ras-like protein 1, kappa B-ras 1, Kappa B-Ras protein 1, KappaB-Ras1, KBRAS1kappaB-Ras1, NF-kappa-B inhibitor-interacting Ras-like protein 1, NFKB inhibitor interacting Ras-like 1, NFKB inhibitor interacting Ras-like protein 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 118-192 of human NKIRAS1 (NP_065078.1). LGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN | |
| 0.1 mL | |
| Signal Transduction | |
| 28512 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction