missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NOLC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38625-25ul
This item is not returnable.
View return policy
Description
NOLC1 Polyclonal specifically detects NOLC1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| NOLC1 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q14978 | |
| NOLC1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKF | |
| 25 μL | |
| Cell Cycle and Replication | |
| 9221 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 140 kDa nucleolar phosphoprotein, HCV NS5A trans-regulated protein 13, HCV NS5A-transactivated protein 13, Hepatitis C virus NS5A-transactivated protein 13, KIAA0035NS5ATP13, NOPP130, NOPP140, Nucleolar 130 kDa protein, nucleolar and coiled-body phosphoprotein 1, nucleolar and coiled-body phosphprotein 1, Nucleolar phosphoprotein p130, nucleolar protein p130, P130 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction