missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NPY4R Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-82534
This item is not returnable.
View return policy
Description
NPY4R Polyclonal specifically detects NPY4R in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| NPY4R | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| neuropeptide Y receptor type 4, NPY4RMGC116897, pancreatic polypeptide receptor 1NPY4-R, PP1Y4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| NPY4R | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSPRLSGRSN | |
| 0.1 mL | |
| GPCR, Neuroscience, Neurotransmission | |
| 5540 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction