missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NSDHL Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Marque: Novus Biologicals NBP3-33288-100ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
NSDHL Monoclonal antibody specifically detects NSDHL in Human samples. It is validated for ELISA,Western Blot
Spécification
| NSDHL | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| EC 1.1.1.170, H105e3, member 1, NAD(P) dependent steroid dehydrogenase-like, SDR31E1, sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating, XAP104 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human NSDHL (NP_057006.1).,, Sequence:, GQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPSSNNKELFYRVNYIGTKNVIETCKEAGVQKLILTSSASVIF | |
| 100 μL | |
| metabolism | |
| 50814 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu