missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OGDH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
386.00 € - 500.00 €
Specifications
| Antigen | OGDH |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|
18446350
|
Novus Biologicals
NBP1-84948-25ul |
25ul |
386.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18221816
|
Novus Biologicals
NBP1-84948 |
0.1 mL |
500.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OGDH Polyclonal specifically detects OGDH in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spécification
| OGDH | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 4967 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FRNTNAGAPPGTAYQSPLPLSRGSLAAVAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| 2-oxoglutarate dehydrogenase complex component E1, 2-oxoglutarate dehydrogenase, mitochondrial, AKGDH, alpha KGD, alpha-KGD, E1k, OGDC, oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide), oxoglutarate decarboxylase, oxoglutarate dehydrogenase (succinyl-transferring) | |
| OGDH | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit