missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR2T10 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94439-0.02ml
This item is not returnable.
View return policy
Description
OR2T10 Polyclonal antibody specifically detects OR2T10 in Human, Mouse samples. It is validated for Western Blot
Specifications
| OR2T10 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| olfactory receptor 2T10, Olfactory receptor OR1-64, olfactory receptor, family 2, subfamily T, member 10, OR1-64 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OR2T10 (NP_001004693.1). MRLANQTLGGDFFLLGIFSQISHPGRLCLLIFSIFLMAVSWNITLILLIHIDSSLHTPMYFFINQLSLIDLTYISVTVPKMLVNQLAKDKTISVLGCGTQ | |
| 0.02 mL | |
| GPCR, Neuroscience, Signal Transduction | |
| 127069 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction