missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Orexin R2/HCRTR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33718
This item is not returnable.
View return policy
Description
Orexin R2/HCRTR2 Polyclonal specifically detects Orexin R2/HCRTR2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Orexin R2/HCRTR2 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| O43614 | |
| HCRTR2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: WCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRK | |
| 0.1 mL | |
| Adaptive Immunity, Cancer, GPCR, Immunology, Neuronal Cell Markers, Neuroscience | |
| 3062 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| hypocretin (orexin) receptor 2, Hypocretin receptor type 2, orexin receptor type 2, ox2-R, Ox-2-R, OX2R | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction