missing translation for 'onlineSavingsMsg'
Learn More

OXR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

433.00 € - 572.00 €

Specifications

Antigen	OXR1
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18441771 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-86393-25ul	25 μL	433.00 € 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18228057 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-86393	0.1 mL	572.00 € 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

OXR1 Polyclonal specifically detects OXR1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	OXR1
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	Q8N573
Gene ID (Entrez)	55074
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:QDSFLHENSLHQEESQKENMPCGETAEFKQKQSVNKGKQGKEQNQDSQTEAEELRKLWKTHTMQQTKQQRENIQQVS
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	FLJ10125, FLJ38829, FLJ40849, FLJ41673, FLJ42450, FLJ45656, oxidation resistance 1, oxidation resistance protein 1, putative protein product of Nbla00307
Gene Symbols	OXR1
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto

Torna in alto

Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Il vostro nome

Indirizzo e-mail *

Tipo di problema *

Descrizione dettagliata del problema/richiesta *

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Annullamento Invia

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato

OXR1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents