missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p53 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56234-25ul
This item is not returnable.
View return policy
Description
p53 Polyclonal specifically detects p53 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| p53 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| Antigen NY-CO-13, FLJ92943, LFS1TRP53, p53, p53 tumor suppressor, P53cellular tumor antigen p53, Phosphoprotein p53, transformation-related protein 53, tumor protein p53, Tumor suppressor p53 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| TP53 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSR | |
| 25 μL | |
| Apoptosis, Cancer, Cell Cycle and Replication, Cellular Markers, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, HIF Target Genes, Hypoxia, Neuroscience, Neurotransmission, p53 Pathway, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors | |
| 7157 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction