missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Parvalbumin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
280.00 € - 624.00 €
Specifications
| Antigen | Parvalbumin |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18477211
|
Novus Biologicals
NBP2-33529-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18116214
|
Novus Biologicals
NBP2-33529 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Parvalbumin Polyclonal specifically detects Parvalbumin in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Parvalbumin | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Rat | |
| P20472 | |
| 5816 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| D22S749, MGC116759, parvalbumin, parvalbumin alpha, PV | |
| PVALB | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title