missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCDHA11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 624.00 €
Specifications
| Antigen | PCDHA11 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18245644
|
Novus Biologicals
NBP2-57691 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18603508
|
Novus Biologicals
NBP2-57691-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PCDHA11 Polyclonal specifically detects PCDHA11 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PCDHA11 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 56138 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VNGEVTYSLMSIKPNGRHLFTLDQNNGEVRVNGTLDYEENKFYKIEVQATDK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| CNR7, CNRN7, CNRS7, CRNR7, KIAA0345-like 3, ortholog of mouse CNR7, PCDH-alpha-11, PCDH-ALPHA11, protocadherin alpha 11, protocadherin alpha-11 | |
| PCDHA11 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title