missing translation for 'onlineSavingsMsg'
Learn More

PCDHA12 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-94710-0.1ml

View more versions of this product

Product Code. 18665601

470.00 € / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beschreibung

PCDHA12 Polyclonal antibody specifically detects PCDHA12 in Human, Mouse, Rat samples. It is validated for Western Blot

Spezifikation

Antigen	PCDHA12
Classification	Polyclonal
Dilution	Western Blot 1:500 - 1:2000
Gene Alias	KIAA0345-like 2, MGC138485, MGC141932, PCDH-alpha-12, PCDH-ALPHA12, protocadherin alpha 12, protocadherin alpha-12
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 713-792 of human PCDHA12 (NP_114070.1). LTLLLYTALRCSAPPTVSRCAPGKPTLVCSSAVGSWSYSQQRRQRVCSAESPPKTDLMAFSPSLQLSREDCLNPPSEVSY
Quantity	0.1 mL
Research Discipline	Cancer, Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Neuroscience, Signal Transduction
Gene ID (Entrez)	56137
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS (pH 7.3), 50% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Form	Purified

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

PCDHA12 Antibody - BSA Free, Novus Biologicals™

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Aktionen