missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDHX Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-84079-25ul
This item is not returnable.
View return policy
Description
PDHX Polyclonal specifically detects PDHX in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PDHX | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenasecomplex, DLDBP, E3-binding protein, E3BPpyruvate dehydrogenase complex, E3-binding protein subunit, OPDX, PDX1Lipoyl-containing pyruvate dehydrogenase complex component X, proXpyruvate dehydrogenase complex, lipoyl-containing component X, pyruvate dehydrogenase complex, component X, pyruvate dehydrogenase protein X component, mitochondrial | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PDHX | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:DASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLS | |
| 25 μL | |
| Lipid and Metabolism | |
| 8050 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction