missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDX-1/IPF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP2-38865-25ul
This item is not returnable.
View return policy
Description
PDX-1/IPF1 Polyclonal specifically detects PDX-1/IPF1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spezifikation
| PDX-1/IPF1 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| P52945 | |
| PDX1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKA | |
| 25 μL | |
| Lipid and Metabolism, Stem Cell Markers | |
| 3651 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Glucose-sensitive factor, IDX-1GSF, Insulin promoter factor 1, insulin promoter factor 1, homeodomain transcription factor, Insulin upstream factor 1, IPF1pancreas/duodenum homeobox protein 1, Islet/duodenum homeobox-1, MODY4IUF1, pancreatic and duodenal homeobox 1, pancreatic-duodenal homeobox factor 1, PDX-1IPF-1, somatostatin transcription factor 1, Somatostatin-transactivating factor 1, STF-1IUF-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur