missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDZRN3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP2-55802-25ul
This item is not returnable.
View return policy
Description
PDZRN3 Polyclonal specifically detects PDZRN3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| PDZRN3 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| E3 ubiquitin-protein ligase PDZRN3, EC 6.3.2.-, Ligand of Numb protein X 3, likely ortholog of mouse semaF cytoplasmic domain associated protein 3, LNX3KIAA1095SEMACAP3, PDZ domain containing ring finger 3, PDZ domain-containing RING finger protein 3, Protein SEMACAP3, Semaphorin cytoplasmic domain-associated protein 3, SEMCAP3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| PDZRN3 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFR | |
| 25 μL | |
| Zinc Finger | |
| 23024 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction