missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Peroxiredoxin Like 2C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91073-25ul
This item is not returnable.
View return policy
Description
Peroxiredoxin Like 2C Polyclonal specifically detects Peroxiredoxin Like 2C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| C9orf21 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| AhpC/TSA antioxidant enzyme domain containing 1, C9orf21, chromosome 9 open reading frame 21, hypothetical protein LOC195827 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 195827 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AAED1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQ | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur