missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEX3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
280.00 € - 624.00 €
Specifications
| Antigen | PEX3 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18490601
|
Novus Biologicals
NBP1-86210-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18236037
|
Novus Biologicals
NBP1-86210 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PEX3 Polyclonal specifically detects PEX3 in Human samples. It is validated for Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PEX3 | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 8504 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Polyclonal | |
| Rabbit | |
| Human | |
| DKFZp686N14184, FLJ13531, Peroxin-3, Peroxisomal assembly protein PEX3, peroxisomal biogenesis factor 3, transformation-related protein 18, TRG18 | |
| PEX3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title