missing translation for 'onlineSavingsMsg'
Learn More

Pin1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

369.00 € - 593.00 €

Specifications

Antigen	Pin1
Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18206704 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-55706	100 μL	593.00 € 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18667936 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-55706-25ul	25 μL	369.00 € 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Pin1 Polyclonal specifically detects Pin1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	Pin1
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication, Mitotic Regulators
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	5300
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Alias	dod, EC 5.2.1.8, peptidyl-prolyl cis/trans isomerase, NIMA-interacting, peptidylprolyl cis/trans isomerase, NIMA-interacting 1, peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, Peptidyl-prolyl cis-trans isomerase Pin1, PPIase Pin1, prolyl isomerase, protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1, protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 1, Rotamase Pin1, UBL5
Gene Symbols	PIN1
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Pin1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents