missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PMCA2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00 € - 470.00 €
Specifications
| Antigen | PMCA2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18677332
|
Novus Biologicals
NBP2-95221-0.02ml |
0.02 mL |
188.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18688152
|
Novus Biologicals
NBP2-95221-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PMCA2 Polyclonal antibody specifically detects PMCA2 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| PMCA2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 491 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| plasma membrane calcium-transporting ATPase 2, ATPase, Ca++ transporting, plasma membrane 2, PMCA2, PMCA2a, PMCA2i | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ATP2B2 (NP_001674.2). MGDMTNSDFYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRLKTSPVEGLPGTAPDLEKRKQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title