missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POLR2K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | POLR2K |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18290865
|
Novus Biologicals
NBP2-55856 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18634097
|
Novus Biologicals
NBP2-55856-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
POLR2K Polyclonal specifically detects POLR2K in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| POLR2K | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, DNA replication Transcription Translation and Splicing | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5440 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| ABC10-alpha, DNA directed RNA polymerases I, II, and III 7.0 kda polypeptide, DNA-directed RNA polymerase II subunit K, DNA-directed RNA polymerases I, II, and III subunit RPABC4, hRPB7.0, hsRPB10a, polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa, RNA polymerase II 7.0 kDa subunit, RNA polymerases I, II, and III subunit ABC4, RPABC4, RPB10alphapolymerase (RNA) II (DNA directed) polypeptide K (7.0kD), RPB12, RPB7.0 | |
| POLR2K | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title