missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PP2A alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46693-25ul
This item is not returnable.
View return policy
Description
PP2A alpha Polyclonal antibody specifically detects PP2A alpha in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| PP2A alpha | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| EC 3.1.3.16, PP2A-alpha, PP2Ac, PP2CA, PP2Calpha, protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform, protein phosphatase 2, catalytic subunit, alpha isozyme, protein phosphatase 2A catalytic subunit, alpha isoform, Replication protein C, RP-C, serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF | |
| 25 μL | |
| Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Neuronal Cell Markers, Neurotransmission, Protein Phosphatase, Signal Transduction | |
| 5515 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction