missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPAP2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-82825
This item is not returnable.
View return policy
Description
PPAP2B Polyclonal specifically detects PPAP2B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PPAP2B | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Dri42, EC 3.1.3.4, lipid phosphate phosphohydrolase 3, LPP3PAP2 beta, MGC15306, PAP2b, PAP-2b, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, phosphatidic acid phosphatase type 2B, type-2 phosphatidic acid phosphatase-beta, vascular endothelial growth factor and type I collagen inducible, Vascular endothelial growth factor and type I collagen-inducible protein, VCIP | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PLPP3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSF | |
| 0.1 mL | |
| Protein Phosphatase | |
| 8613 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion