missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPP1R7 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00 € - 470.00 €
Specifications
| Antigen | PPP1R7 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18680282
|
Novus Biologicals
NBP2-94215-0.02ml |
0.02 mL |
188.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18667922
|
Novus Biologicals
NBP2-94215-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PPP1R7 Polyclonal antibody specifically detects PPP1R7 in Human, Mouse samples. It is validated for Western BlotSpecifications
| PPP1R7 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 5510 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| Protein phosphatase 1 regulatory subunit 22, protein phosphatase 1 regulatory subunit 7, protein phosphatase 1, regulatory (inhibitor) subunit 7, protein phosphatase-1 regulatory subunit 7 alpha2, protein phosphatase-1 regulatory subunit 7 beta1, protein phosphatase-1 regulatory subunit 7 beta2, regulatory subunit 7, sds22 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 281-360 of human PPP1R7 (NP_002703.1). IASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title