missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPP3CB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-86657
This item is not returnable.
View return policy
Description
PPP3CB Polyclonal specifically detects PPP3CB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PPP3CB | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Calmodulin-dependent calcineurin A subunit beta isoform, CALNA2protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform(calcineurin A beta), CAM-PRP catalytic subunit, CNA2catalytic subunit, beta isoform, EC 3.1.3.16, protein phosphatase 2B, catalytic subunit, beta isoform, protein phosphatase 3, catalytic subunit, beta isozyme, protein phosphatase from PCR fragment H32, serine/threonine-protein phosphatase 2B catalytic subunit beta isoform | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 5532 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PPP3CB | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITV | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction