missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Protocadherin-17 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94167-0.1ml
This item is not returnable.
View return policy
Description
Protocadherin-17 Polyclonal antibody specifically detects Protocadherin-17 in Human samples. It is validated for Western Blot
Specifications
| Protocadherin-17 | |
| Polyclonal | |
| Western Blot 1:500-1:1000 | |
| PCDH68protocadherin-68, PCH68Protocadherin-68, protocadherin 17, protocadherin 68, protocadherin-17 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 610-710 of human PCDH17 (NP_001035519.1). VRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWDMSLPLIV | |
| 0.1 mL | |
| Cell Biology, Cytoskeleton Markers, Neuroscience, Signal Transduction | |
| 27253 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction