Learn More
pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal Antibody,Lab Vision™ Epredia™
Provide accurate, reproducible results with the Epredia™ pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal Antibody.
Brand: Epredia MS-111-P0
Description
pS2 is a cysteine-rich, 6.5kDa protein found in both estrogen-dependent (breast tumors) and estrogen-independent tissues (normal stomach mucosa). About 60% of breast carcinomas are positive for pS2. Staining is cytoplasmic, often with localization to the Golgi apparatus. pS2 is primarily expressed in estrogen receptor-positive breast tumors.Host Species: Mouse
Clone: pS2.1
Isotype: IgG1
Species Reactivity: Human. Others not known.
Epitope: aa 54-84
Immunogen: A synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein
Molecular Weight: 6.5kDa
Cellular Localization: Cytoplasmic Antibody to pS2 is reportedly useful in identifying a subset of estrogen-dependent breast tumors which may respond to endocrine therapy.
Recommended for:
- Immunohistochemistry
Note:
USA: RUO; Int'l: RUO
Specifications
| pS2/pNR-2 Estrogen-Regulated Protein Ab-1 | |
| Monoclonal | |
| 200μg/mL | |
| Mouse | |
| 100 μL | |
| Cancer and Tumor Biology | |
| Human | |
| IgG1 |
| Immunohistochemistry (Paraffin) | |
| pS2.1 | |
| Unconjugated | |
| A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein | |
| RUO | |
| Primary | |
| Concentrated |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.