missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSP94/MSMB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33610-25ul
This item is not returnable.
View return policy
Description
PSP94/MSMB Polyclonal specifically detects PSP94/MSMB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Prostate Secretory Protein/PSP | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P08118 | |
| MSMB | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPK | |
| 25 μL | |
| Cancer | |
| 4477 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| beta-microseminoprotein, IGBFProstate secreted seminal plasma protein, immunoglobulin binding factor, Immunoglobulin-binding factor, microseminoprotein, beta-, MSP, MSPB, PN44Prostate secretory protein of 94 amino acids, prostatic secretory protein 94, PRPS, PRSP, PSP, PSP57, PSP94HPC13, PSP-94Seminal plasma beta-inhibin | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction