missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSPC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 518.00 €
Specifications
| Antigen | PSPC1 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunohistochemistry-Frozen PSPC1 antibody validated for IHC-FR from a verified customer review. |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18489800
|
Novus Biologicals
NBP1-83801-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18234818
|
Novus Biologicals
NBP1-83801 |
0.1 mL |
518.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PSPC1 Polyclonal specifically detects PSPC1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
| PSPC1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| 55269 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunohistochemistry-Frozen PSPC1 antibody validated for IHC-FR from a verified customer review. | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| FLJ33554, paraspeckle component 1, paraspeckle protein 1, PSP1 | |
| PSPC1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title