missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PWWP2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP2-13833-25ul
This item is not returnable.
View return policy
Description
PWWP2A Polyclonal specifically detects PWWP2A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| PWWP2A | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| KIAA1935, MST101, MSTP101, PWWP domain containing 2A, PWWP domain-containing protein 2A | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 114825 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PWWP2A | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: QSNTFQEGTEVKCEANGAVPDDPSPVPHPELSLAESLWTSKPPPLFHEGAPYPPPLFIRDTYNQSIPQPPP | |
| 25ul | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction