missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RanBP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 529.00 €
Specifications
| Antigen | RanBP2 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18408851
|
Novus Biologicals
NBP2-33881-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18114974
|
Novus Biologicals
NBP2-33881 |
0.1 mL |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RanBP2 Polyclonal specifically detects RanBP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RanBP2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ANE1, E3 SUMO-protein ligase RanBP2, EC 5.2.1.8, Nuclear pore complex protein Nup358, nucleoporin 358, Nucleoporin Nup358, NUP358TRP2, P270, RAN binding protein 2, Ran-binding protein 2, RanBP2, transformation-related protein 2,358 kDa nucleoporin, TRP1 | |
| RANBP2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P49792 | |
| 5903 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SNSESLLGLLTSDKPLQGDGYSGAKPIPGGQTIGPRNTFNFGSKNVSGISFTENMGSSQQKNSGFRRSDDMFTFHGPGKSVFGTPTL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title