missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM48 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00 €
Specifications
| Antigen | C7orf64 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RBM48 Polyclonal specifically detects RBM48 in Human samples. It is validated for Western Blot.Specifications
| C7orf64 | |
| Polyclonal | |
| Rabbit | |
| NP_115496 | |
| 84060 | |
| Synthetic peptide directed towards the C terminal of human DKFZP564O0523. Peptide sequence FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C7orf64, chromosome 7 open reading frame 64, DKFZp564O0523, DKFZp686D1651, HSPC304, hypothetical protein LOC84060, RNA binding motif protein 48 | |
| RBM48 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title