missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Mouse IL 17 A/F Protein
A cDNA sequence encoding the IL 17 A/F was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12392-10ug
Additional Details : Weight : 0.01000kg
Specifications
| IL 17 A/F Protein | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA | |
| Greater than 97.0% as determined by SDS-PAGE. |
| 10 μg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Mouse | |
| Untagged | |
| Lyophilized from a concentrated (1 mg/ml) solution containing no additives. |