missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Porcine Trypsin Protein

A cDNA sequence encoding the Trypsin was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP10897-1mg

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15985498

Quantity Price
1 114.77 € / 1mg
10 107.33 € / 1mg
Estimated Shipment: 18-11-2021

Please to purchase this item. Need a web account? Register with us today!



Description

Description

Specifications

Specifications

Trypsin Protein
Research Use Only
Recombinant Protein
Pichia Pastoris
VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN
1 mg
< 1.0 EU per ug protein as determined by the LAL method.
Porcine
Untagged
The Porcine Trypsin (2.98 mg/ml) is formulated with 1mM HCl and 20mM CaCl2, pH 3.
Videos
SDS
Documents
Certificates