missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rabbit GHBP Protein
A cDNA sequence encoding the GHBP was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP10642-20ug
Additional Details : Weight : 0.01000kg
Specifications
GHBP Protein | |
20 μg | |
< 1.0 EU per ug protein as determined by the LAL method. | |
Recombinant Protein | |
E. coli | |
AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP |
Greater than 98.0% as determined bySDS-PAGE. | |
Research Use Only | |
Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones. | |
Rabbit | |
Untagged | |
The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1 mg/ml) solution with 0.0045mM NaHCO3. |