missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rabbit IL 8 Protein
A cDNA sequence encoding the IL 8 was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12400-5ug
Additional Details : Weight : 0.01000kg
Specifications
100009129 | |
Greater than 90% as determined by SDS-PAGE. | |
Research Use Only | |
CXCL8 | |
Rabbit | |
His | |
The IL-8 solution (1 mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5. |
IL 8 Protein | |
5 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Recombinant Protein | |
E. coli | |
AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV QIFLKRAEQQES |