missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rabbit VCAM1 Protein

A cDNA sequence encoding the VCAM1 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13929-10ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15985149

Quantity Price
1 171.64 € / 10µg
10 161.27 € / 10µg
Estimated Shipment: 26-11-2021

Please to purchase this item. Need a web account? Register with us today!



Description

Description

Specifications

Specifications

100008901
Greater than 90% as determined by SDS-PAGE.
Research Use Only
VCAM-1
Rabbit
His
The VCAM1 solution (1 mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
VCAM1 Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
Insect
AFKIETFPESRSLAQIGDSVSLTCTTTGCASPTFSWRTQIDSPLNGKVRSEGTTSTLTMDPVSFENE HSYLCTATCESKKLEKGIQVEIYSFPKDPEIHLSGPLEVGEPITVKCLVPDVYPFDRLEVDLLKGDYLM KKQDFLEDMDRKSLETKSLEVTFIPVIEDIGKLIVCRAKLHIDEIDSEPKERETTKELQVYISPKNTVIS VNPSTRLQEGGSVTMTCSSEGLPVPEIFWSKKQDNGNLQRLSGNATLTLIAMRMEDSGIYVCEG VNQIGKSRKEVELIVQEKPFTVEISPGPRIAAQIGDPVVLTCSVRGCETPSFSWRTQIDSPLNGQVT SEGTKSLLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIELSGPPVNGRPVTVSCKVP NVYPFDXLEIELLKGETMMKNKEFLEEEDKKSLETKSLEMTFIPTMEDTGKVLVCQAKLHIDEMEF EPKQRQSTQPLFVNVAPRDIAVWVSPSSIVEEGRSVNMTCSSYGLPAPKILWSRQLKNGDLQPLS ENTTLALISTKLEDSGIYVCEGINLAGKSRKEVELVIQVAPKDIQLTAFPSKSVKEGDTVIISCTCGNV PETWIILKKKAETGDTVLKSIDGAYTIRKAQLEDAGVYECESKNEVGSQLRSITLDVKGRENSKDYF SPE
Videos
SDS
Documentos
Certificados