missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rat CNTF Protein
A cDNA sequence encoding the CNTF was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP10559-5ug
Additional Details : Weight : 0.01000kg
Specifications
CNTF Protein | |
Research Use Only | |
Fully biologically active by its ability to phosphorylate STAT3 in several cells lines. | |
Rat | |
Untagged | |
Lyophilized from a concentrated (1 mg/ml) solution in water containing 0.025% NaHCO3. |
5 μg | |
< 1.0 EU per ug protein as determined by the LAL method. | |
Recombinant Protein | |
E. coli | |
AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM | |
Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE. |