missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rat CNTF Protein
A cDNA sequence encoding the CNTF was constructed and used to recombinantly synthesize the protein.
131.00 € - 3915.00 €
Specifications
Name | CNTF Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | < 1.0 EU per ug protein as determined by the LAL method. |
Biological Activity | Fully biologically active by its ability to phosphorylate STAT3 in several cells lines. |
Product Type | Recombinant Protein |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15934248
|
enQuireBio™
QP10559-5UG |
5 μg |
131.00 €
5µg |
Estimated Shipment: 27-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15924248
|
enQuireBio™
QP10559-25UG |
25 μg |
203.00 €
25µg |
Estimated Shipment: 27-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15914248
|
enQuireBio™
QP10559-1MG |
1 mg |
3915.00 €
1mg |
Estimated Shipment: 27-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
CNTF Protein | |
< 1.0 EU per ug protein as determined by the LAL method. | |
Recombinant Protein | |
E. coli | |
AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM | |
Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE. |
Research Use Only | |
Fully biologically active by its ability to phosphorylate STAT3 in several cells lines. | |
Rat | |
Untagged | |
Lyophilized from a concentrated (1 mg/ml) solution in water containing 0.025% NaHCO3. |