missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat Tpc1808 Protein

A cDNA sequence encoding the Tpc1808 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13791-50ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15934719

  • 181.00 € / 50µg
Estimated Shipment: 13-01-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

Tpc1808 Protein
50 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Rat
His
The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS
Videos
SDS
Documents
Certificates
Special Offers

Special Offers