missing translation for 'onlineSavingsMsg'
Learn More
Learn More
REEP6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-37919-25ul
This item is not returnable.
View return policy
Description
REEP6 Polyclonal specifically detects REEP6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| REEP6 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q96HR9 | |
| REEP6 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVT | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C19orf32deleted in polyposis 1-like 1, DP1L1chromosome 19 open reading frame 32, FLJ25383, Polyposis locus protein 1-like 1, receptor accessory protein 6, receptor expression enhancing protein 6, receptor expression-enhancing protein 6, TB2L1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 92840 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction