missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RelA/NFkB p65 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56067
This item is not returnable.
View return policy
Description
RelA/NFkB p65 Polyclonal specifically detects RelA/NFkB p65 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| RelA/NFkB p65 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| MGC131774, nf kb p65, NFkB p65, NF-kB p65, NFKB3v-rel avian reticuloendotheliosis viral oncogene homolog A (nuclear factor ofkappa light polypeptide gene enhancer in B-cells 3 (p65)), Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3transcription factor p65, p65, RelA, rela p65, v-rel reticuloendotheliosis viral oncogene homolog A (avian), v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappalight polypeptide gene enhancer in B-cells 3, p65 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| RELA | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC | |
| 100 μL | |
| Apoptosis, Cancer, Cell Biology, Immune System Diseases, Immunology, Innate Immunity, Neurodegeneration, Neuroscience, Signal Transduction, Transcription Factors and Regulators | |
| 5970 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction