missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RFX6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 549.00 €
Specifications
| Antigen | RFX6 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18621407
|
Novus Biologicals
NBP2-48677 |
0.1 mL |
549.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18647217
|
Novus Biologicals
NBP2-48677-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RFX6 Polyclonal antibody specifically detects RFX6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| RFX6 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| dJ955L16.1, DNA-binding protein RFX6, MGC33442, Regulatory factor X 6, Regulatory factor X domain-containing protein 1, regulatory factor X, 6, RFXDC1regulatory factor X domain containing 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SHCSTYPEPIYPTLPQANHDFYSTSSNYQTVFRAQPHSTSGLYPHHTEHGRCMAWTEQQLSRDFFSGSCAGSPYNSRPPSSYGPSLQ | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 222546 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title